PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_09794
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family NAC
Protein Properties Length: 280aa    MW: 32398.4 Da    PI: 9.7457
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_09794genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM175.41.7e-5461331128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 
                 lppGfrFhPtd+elv +yLk+kv+g+k+el evi+ vd+yk++PwdLp k  + +++ ew+fF++rd+ky++g+r+nrat+sgyWkatgkd+++++ + 
  PEQU_09794   6 LPPGFRFHPTDDELVGYYLKRKVDGQKIEL-EVIPVVDLYKFDPWDLPeKsFLPKRDMEWFFFCPRDRKYPNGSRTNRATNSGYWKATGKDRKITC-EF 102
                 79****************************.99**************95344555788**************************************.88 PP

         NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                 +  g++ktLvfy+grap ge+tdWvmheyrl
  PEQU_09794 103 SIEGMRKTLVFYRGRAPGGERTDWVMHEYRL 133
                 89***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.18E-593151IPR003441NAC domain
PROSITE profilePS5100556.5786152IPR003441NAC domain
PfamPF023652.9E-307133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008283Biological Processcell proliferation
GO:0071365Biological Processcellular response to auxin stimulus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 280 aa     Download sequence    Send to blast
MGPMSLPPGF RFHPTDDELV GYYLKRKVDG QKIELEVIPV VDLYKFDPWD LPEKSFLPKR  60
DMEWFFFCPR DRKYPNGSRT NRATNSGYWK ATGKDRKITC EFSIEGMRKT LVFYRGRAPG  120
GERTDWVMHE YRLCEHLPQG TVSFMVCKIT NSSFFLTRMQ IFKCFKKIYL FILQGAYALC  180
RVVKRNEHQG VSKVKRVLFS VTSETNKRKC NSKVSSSSLE GNSAQVVNLL DVSNGPIHAN  240
CLNETDFELA SSMVDVSPSQ YRGPLFSSYY PLKVRFMTFL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-55413313140Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00439DAPTransfer from AT4G17980Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010933504.11e-101PREDICTED: NAC domain-containing protein 45-like
RefseqXP_010933505.11e-101PREDICTED: NAC domain-containing protein 45-like
SwissprotQ9FFI51e-71NAC86_ARATH; NAC domain-containing protein 86
TrEMBLB9N2P75e-92B9N2P7_POPTR; Uncharacterized protein
STRINGPOPTR_0003s08830.11e-91(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62093854
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17980.14e-82NAC domain containing protein 71